Recombinant Full Length Human HIST1H2AB Protein, GST-tagged

Cat.No. : HIST1H2AB-3568HF
Product Overview : Human HIST1H2AB full-length ORF ( AAI66650.1, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 130 amino acids
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H2A family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq
Molecular Mass : 14.3 kDa
AA Sequence : MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HIST1H2AB histone cluster 1 H2A family member b [ Homo sapiens (human) ]
Official Symbol HIST1H2AB
Synonyms HIST1H2AB; histone cluster 1 H2A family member b; H2A/m; H2AFM; histone H2A type 1-B/E; H2A histone family, member M; histone 1, H2ab; histone H2A/m; histone cluster 1, H2ab
Gene ID 8335
mRNA Refseq NM_003513
Protein Refseq NP_003504
MIM 602795
UniProt ID P04908

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HIST1H2AB Products

Required fields are marked with *

My Review for All HIST1H2AB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon