Recombinant Full Length Human HIST2H2BE Protein, GST-tagged

Cat.No. : HIST2H2BE-3600HF
Product Overview : Human HIST2H2BE full-length ORF ( NP_003519.1, 1 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 126 amino acids
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a member of the histone H2B family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. [provided by RefSeq
Molecular Mass : 40.3 kDa
AA Sequence : MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HIST2H2BE histone cluster 2, H2be [ Homo sapiens ]
Official Symbol HIST2H2BE
Synonyms HIST2H2BE; histone cluster 2, H2be; histone H2B type 2-E; histone H2B.q; histone 2, H2be; histone H2B-GL105; H2B histone family, member Q; H2B; H2BQ; GL105; H2B.1; H2BFQ; H2BGL105; MGC119802; MGC119804; MGC129733; MGC129734;
Gene ID 8349
mRNA Refseq NM_003528
Protein Refseq NP_003519
MIM 601831
UniProt ID Q16778

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HIST2H2BE Products

Required fields are marked with *

My Review for All HIST2H2BE Products

Required fields are marked with *

0
cart-icon