Recombinant Full Length Human HMGN1 Protein

• Cat.No.: HMGN1-243HF
• Product Overview: Recombinant full length Human HMG14 with a proprietary tag; Predicted MWt 37.11.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 100 amino acids
• Description: The protein encoded by this gene binds nucleosomal DNA and is associated with transcriptionally active chromatin. Along with a similar protein, HMG17, the encoded protein may help maintain an open chromatin configuration around transcribable genes.
• Form: Liquid
• Molecular Mass: 37.110kDa
• AA Sequence: MPKRKVSSTEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: HMGN1 high mobility group nucleosome binding domain 1 [ Homo sapiens ]
• Official Symbol: HMGN1
• Synonyms: HMGN1; high mobility group nucleosome binding domain 1; high mobility group (nonhistone chromosomal) protein 14 , high mobility group nucleosome binding domain 1 , HMG14; non-histone chromosomal protein HMG-14; FLJ27265; FLJ31471; high mobility group nuc
• Gene ID: 3150
• mRNA Refseq: NM_004965
• Protein Refseq: NP_004956
• MIM: 163920
• UniProt ID: P05114