Recombinant Full Length Human HMGN1 Protein
| Cat.No. : | HMGN1-243HF |
| Product Overview : | Recombinant full length Human HMG14 with a proprietary tag; Predicted MWt 37.11. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 100 amino acids |
| Description : | The protein encoded by this gene binds nucleosomal DNA and is associated with transcriptionally active chromatin. Along with a similar protein, HMG17, the encoded protein may help maintain an open chromatin configuration around transcribable genes. |
| Form : | Liquid |
| Molecular Mass : | 37.110kDa |
| AA Sequence : | MPKRKVSSTEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | HMGN1 high mobility group nucleosome binding domain 1 [ Homo sapiens ] |
| Official Symbol | HMGN1 |
| Synonyms | HMGN1; high mobility group nucleosome binding domain 1; high mobility group (nonhistone chromosomal) protein 14 , high mobility group nucleosome binding domain 1 , HMG14; non-histone chromosomal protein HMG-14; FLJ27265; FLJ31471; high mobility group nuc |
| Gene ID | 3150 |
| mRNA Refseq | NM_004965 |
| Protein Refseq | NP_004956 |
| MIM | 163920 |
| UniProt ID | P05114 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HMGN1 Products
Required fields are marked with *
My Review for All HMGN1 Products
Required fields are marked with *




