Recombinant Full Length Human HSF2BP Protein, GST-tagged
Cat.No. : | HSF2BP-3889HF |
Product Overview : | Human HSF2BP full-length ORF ( NP_008962.1, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 334 amino acids |
Description : | HSF2 binding protein (HSF2BP) associates with HSF2. The interaction occurs between the trimerization domain of HSF2 and the amino terminal hydrophilic region of HSF2BP that comprises two leucine zipper motifs. HSF2BP may therefore be involved in modulating HSF2 activation. [provided by RefSeq |
Molecular Mass : | 64 kDa |
AA Sequence : | MGEAGAAEEACRHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIVEKNLERKEQELEQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEVVKAILGGDKALKFFSITGQTMESFVKSLDGDVQELDSDESQFVFALAGIVTNVAAIACGREFLVNSSRVLLDTILQLLGDLKPGQCTKLKVLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQSVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HSF2BP heat shock transcription factor 2 binding protein [ Homo sapiens ] |
Official Symbol | HSF2BP |
Synonyms | HSF2BP; heat shock transcription factor 2 binding protein; heat shock factor 2-binding protein; heat shock factor 2 binding protein; |
Gene ID | 11077 |
mRNA Refseq | NM_007031 |
Protein Refseq | NP_008962 |
MIM | 604554 |
UniProt ID | O75031 |
◆ Recombinant Proteins | ||
HSF2BP-129H | Recombinant Human HSF2BP protein, T7-tagged | +Inquiry |
HSF2BP-3889HF | Recombinant Full Length Human HSF2BP Protein, GST-tagged | +Inquiry |
HSF2BP-2925H | Recombinant Human HSF2BP, T7-tagged | +Inquiry |
Hsf2bp-6729M | Recombinant Mouse Hsf2bp Protein (Ala2-Ala332), N-His tagged | +Inquiry |
HSF2BP-5089H | Recombinant Human HSF2BP Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSF2BP-5365HCL | Recombinant Human HSF2BP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSF2BP Products
Required fields are marked with *
My Review for All HSF2BP Products
Required fields are marked with *