Recombinant Human HSF2BP protein, T7-tagged
| Cat.No. : | HSF2BP-212H |
| Product Overview : | Recombinant human HSF2BP fused with T7 Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | T7 |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine and DTT. |
| AA Sequence : | MASMTGGQQMGRGEFGSGEAGAAEEACRHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKI VEKNLERKEQELEQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGV SSSEEVVKAILGGDKALKFFSITGQTMESFVKSLDGDVQELDSDESQFVFALAGIVTNVAAIACGREFLVNSSRV LLDTILQLLGDLKPGQCTKLKVLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQSVVL EPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV |
| Purity : | >90% by SDS-PAGE |
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
| Gene Name | HSF2BP heat shock transcription factor 2 binding protein [ Homo sapiens ] |
| Official Symbol | HSF2BP |
| Synonyms | HSF2BP; heat shock transcription factor 2 binding protein; heat shock factor 2-binding protein; heat shock factor 2 binding protein; |
| Gene ID | 11077 |
| mRNA Refseq | NM_007031 |
| Protein Refseq | NP_008962 |
| MIM | 604554 |
| UniProt ID | O75031 |
| Chromosome Location | 21q22.3 |
| Function | binding; |
| ◆ Recombinant Proteins | ||
| Hsf2bp-3447M | Recombinant Mouse Hsf2bp Protein, Myc/DDK-tagged | +Inquiry |
| HSF2BP-5089H | Recombinant Human HSF2BP Protein, GST-tagged | +Inquiry |
| HSF2BP-129H | Recombinant Human HSF2BP protein, T7-tagged | +Inquiry |
| HSF2BP-3889HF | Recombinant Full Length Human HSF2BP Protein, GST-tagged | +Inquiry |
| HSF2BP-212H | Recombinant Human HSF2BP protein, T7-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSF2BP-5365HCL | Recombinant Human HSF2BP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSF2BP Products
Required fields are marked with *
My Review for All HSF2BP Products
Required fields are marked with *
