Recombinant Full Length Human ID3 Protein

Cat.No. : ID3-247HF
Product Overview : Recombinant full length Human ID3 with a proprietary tag; Predicted MWt 39.09.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 119 amino acids
Description : The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it interacts.
Form : Liquid
Molecular Mass : 39.090kDa inclusive of tags
AA Sequence : MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein [ Homo sapiens ]
Official Symbol ID3
Synonyms ID3; inhibitor of DNA binding 3, dominant negative helix-loop-helix protein; DNA-binding protein inhibitor ID-3; bHLHb25; HEIR 1
Gene ID 3399
mRNA Refseq NM_002167
Protein Refseq NP_002158
MIM 600277
UniProt ID Q02535

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ID3 Products

Required fields are marked with *

My Review for All ID3 Products

Required fields are marked with *

0
cart-icon
0
compare icon