Recombinant Full Length Human ID3 Protein

• Cat.No.: ID3-247HF
• Product Overview: Recombinant full length Human ID3 with a proprietary tag; Predicted MWt 39.09.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 119 amino acids
• Description: The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it interacts.
• Form: Liquid
• Molecular Mass: 39.090kDa inclusive of tags
• AA Sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein [ Homo sapiens ]
• Official Symbol: ID3
• Synonyms: ID3; inhibitor of DNA binding 3, dominant negative helix-loop-helix protein; DNA-binding protein inhibitor ID-3; bHLHb25; HEIR 1
• Gene ID: 3399
• mRNA Refseq: NM_002167
• Protein Refseq: NP_002158
• MIM: 600277
• UniProt ID: Q02535