Recombinant Full Length Human ID3 Protein, C-Flag-tagged
Cat.No. : | ID3-1176HFL |
Product Overview : | Recombinant Full Length Human ID3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it interacts. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 12.8 kDa |
AA Sequence : | MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEIL QRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
Protein Pathways : | TGF-beta signaling pathway |
Full Length : | Full L. |
Gene Name | ID3 inhibitor of DNA binding 3 [ Homo sapiens (human) ] |
Official Symbol | ID3 |
Synonyms | HEIR-1; bHLHb25 |
Gene ID | 3399 |
mRNA Refseq | NM_002167.5 |
Protein Refseq | NP_002158.3 |
MIM | 600277 |
UniProt ID | Q02535 |
◆ Recombinant Proteins | ||
ID3-1176HFL | Recombinant Full Length Human ID3 Protein, C-Flag-tagged | +Inquiry |
ID3-2638R | Recombinant Rat ID3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ID3-7981M | Recombinant Mouse ID3 Protein | +Inquiry |
ID3-2983R | Recombinant Rat ID3 Protein | +Inquiry |
ID3-28591TH | Recombinant Human ID3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ID3-5310HCL | Recombinant Human ID3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ID3 Products
Required fields are marked with *
My Review for All ID3 Products
Required fields are marked with *
0
Inquiry Basket