Recombinant Full Length Human ID3 Protein, C-Flag-tagged

Cat.No. : ID3-1176HFL
Product Overview : Recombinant Full Length Human ID3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it interacts.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 12.8 kDa
AA Sequence : MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEIL
QRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
Protein Pathways : TGF-beta signaling pathway
Full Length : Full L.
Gene Name ID3 inhibitor of DNA binding 3 [ Homo sapiens (human) ]
Official Symbol ID3
Synonyms HEIR-1; bHLHb25
Gene ID 3399
mRNA Refseq NM_002167.5
Protein Refseq NP_002158.3
MIM 600277
UniProt ID Q02535

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ID3 Products

Required fields are marked with *

My Review for All ID3 Products

Required fields are marked with *

0
cart-icon
0
compare icon