Recombinant Human ID3

• Cat.No.: ID3-28591TH
• Product Overview: Recombinant fragment of Human ID3 with N terminal proprietary tag, 34.76kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 83 amino acids
• Description: The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it interacts.
• Molecular Weight: 34.760kDa inclusive of tags
• Tissue specificity: Expressed abundantly in lung, kidney and adrenal gland, but not in adult brain.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVV
• Sequence Similarities: Contains 1 basic helix-loop-helix (bHLH) domain.

Gene Information

• Gene Name: ID3 inhibitor of DNA binding 3, dominant negative helix-loop-helix protein [ Homo sapiens ]
• Official Symbol: ID3
• Synonyms: ID3; inhibitor of DNA binding 3, dominant negative helix-loop-helix protein; DNA-binding protein inhibitor ID-3; bHLHb25; HEIR 1
• Gene ID: 3399
• mRNA Refseq: NM_002167
• Protein Refseq: NP_002158
• MIM: 600277
• Uniprot ID: Q02535
• Chromosome Location: 1p36.13-p36.12
• Pathway: Adipogenesis, organism-specific biosystem; Id Signaling Pathway, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem
• Function: protein domain specific binding; transcription corepressor activity; transcription factor binding