Recombinant Full Length Human IFT27 Protein, C-Flag-tagged

Cat.No. : IFT27-1972HFL
Product Overview : Recombinant Full Length Human IFT27 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a GTP-binding protein that is a core component of the intraflagellar transport complex B. Characterization of the similar Chlamydomonas protein indicates a function in cell cycle control. Alternative splicing of this gene results in multiple transcript variants.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 20.2 kDa
AA Sequence : MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKEL FSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARA WALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Full Length : Full L.
Gene Name IFT27 intraflagellar transport 27 [ Homo sapiens (human) ]
Official Symbol IFT27
Synonyms RAYL; BBS19; RABL4; FAP156; CFAP156
Gene ID 11020
mRNA Refseq NM_006860.5
Protein Refseq NP_006851.1
MIM 615870
UniProt ID Q9BW83

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFT27 Products

Required fields are marked with *

My Review for All IFT27 Products

Required fields are marked with *

0
cart-icon
0
compare icon