Recombinant Full Length Human IRX2 Protein, GST-tagged
| Cat.No. : | IRX2-5750HF |
| Product Overview : | Human IRX2 full-length ORF ( NP_150366.1, 1 a.a. - 471 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 471 amino acids |
| Description : | IRX2 is a member of the Iroquois homeobox gene family. Members of this family appear to play multiple roles during pattern formation of vertebrate embryos.[supplied by OMIM |
| Molecular Mass : | 75.5 kDa |
| AA Sequence : | MSYPQGYLYQAPGSLALYSCPAYGASALAAPRSEELARSASGSAFSPYPGSAAFTAQAATGFGSPLQYSADAAAAAAGFPSYMGAPYDAHTTGMTGAISYHPYGSAAYPYQLNDPAYRKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRNKSEDEDEDEGDATRSKDESPDKAQEGTETSAEDEGISLHVDSLTDHSCSAESDGEKLPCRAGDPLCESGSECKDKYDDLEDDEDDDEEGERGLAPPKPVTSSPLTGLEAPLLSPPPEAAPRGGRKTPQGSRTSPGAPPPASKPKLWSLAEIATSDLKQPSLGPGCGPPGLPAAAAPASTGAPPGGSPYPASPLLGRPLYYTSPFYGNYTNYGNLNAALQGQGLLRYNSAAAAPGEALHTAPKAASDAGKAGAHPLESHYRSPGGGYEPKKDASEGCTVVGGGVQPYL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | IRX2 iroquois homeobox protein 2 [ Homo sapiens ] |
| Official Symbol | IRX2 |
| Synonyms | IRX2; iroquois homeobox protein 2 |
| Gene ID | 93965 |
| mRNA Refseq | NM_001134222 |
| Protein Refseq | NP_001127694 |
| MIM | 606198 |
| UniProt ID | Q9BZI1 |
| ◆ Recombinant Proteins | ||
| IRX2-4614M | Recombinant Mouse IRX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| IRX2-8318M | Recombinant Mouse IRX2 Protein | +Inquiry |
| IRX2-2222C | Recombinant Chicken IRX2 | +Inquiry |
| IRX2-5750HF | Recombinant Full Length Human IRX2 Protein, GST-tagged | +Inquiry |
| IRX2-5025H | Recombinant Human IRX2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IRX2-873HCL | Recombinant Human IRX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRX2 Products
Required fields are marked with *
My Review for All IRX2 Products
Required fields are marked with *



