Recombinant Full Length Human IRX2 Protein, GST-tagged
Cat.No. : | IRX2-5750HF |
Product Overview : | Human IRX2 full-length ORF ( NP_150366.1, 1 a.a. - 471 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 471 amino acids |
Description : | IRX2 is a member of the Iroquois homeobox gene family. Members of this family appear to play multiple roles during pattern formation of vertebrate embryos.[supplied by OMIM |
Molecular Mass : | 75.5 kDa |
AA Sequence : | MSYPQGYLYQAPGSLALYSCPAYGASALAAPRSEELARSASGSAFSPYPGSAAFTAQAATGFGSPLQYSADAAAAAAGFPSYMGAPYDAHTTGMTGAISYHPYGSAAYPYQLNDPAYRKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWAPRNKSEDEDEDEGDATRSKDESPDKAQEGTETSAEDEGISLHVDSLTDHSCSAESDGEKLPCRAGDPLCESGSECKDKYDDLEDDEDDDEEGERGLAPPKPVTSSPLTGLEAPLLSPPPEAAPRGGRKTPQGSRTSPGAPPPASKPKLWSLAEIATSDLKQPSLGPGCGPPGLPAAAAPASTGAPPGGSPYPASPLLGRPLYYTSPFYGNYTNYGNLNAALQGQGLLRYNSAAAAPGEALHTAPKAASDAGKAGAHPLESHYRSPGGGYEPKKDASEGCTVVGGGVQPYL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IRX2 iroquois homeobox protein 2 [ Homo sapiens ] |
Official Symbol | IRX2 |
Synonyms | IRX2; iroquois homeobox protein 2 |
Gene ID | 93965 |
mRNA Refseq | NM_001134222 |
Protein Refseq | NP_001127694 |
MIM | 606198 |
UniProt ID | Q9BZI1 |
◆ Recombinant Proteins | ||
IRX2-162H | Recombinant Human IRX2, His-tagged | +Inquiry |
IRX2-5750HF | Recombinant Full Length Human IRX2 Protein, GST-tagged | +Inquiry |
IRX2-2222C | Recombinant Chicken IRX2 | +Inquiry |
IRX2-5025H | Recombinant Human IRX2 Protein, GST-tagged | +Inquiry |
IRX2-4614M | Recombinant Mouse IRX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRX2-873HCL | Recombinant Human IRX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IRX2 Products
Required fields are marked with *
My Review for All IRX2 Products
Required fields are marked with *
0
Inquiry Basket