Recombinant Full Length Human KLHL40 Protein, C-Flag-tagged
| Cat.No. : | KLHL40-1510HFL |
| Product Overview : | Recombinant Full Length Human KLHL40 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a protein containing a BACK domain, a BTB/POZ domain, and 5 Kelch repeats, however, its exact function is not known. The gene and the multi-domain protein structure are conserved across different taxa, including primates, rodents, chicken and zebrafish. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 69.1 kDa |
| AA Sequence : | MALGLEQAEEQRLYQQTLLQDGLKDMLDHGKFLDCVVRAGEREFPCHRLVLAACSPYFRARFLAEPERAG ELHLEEVSPDVVAQVLHYLYTSEIALDEASVQDLFAAAHRFQIPSIFTICVSFLQKRLCLSNCLAVFRLG LLLDCARLAVAARDFICAHFTLVARDADFLGLSADELIAIISSDGLNVEKEEAVFEAVMRWAGSGDAEAQ AERQRALPTVFESVRCRLLPRAFLESRVERHPLVRAQPELLRKVQMVKDAHEGRITTLRKKKKGKDGAGA KEADKGTSKAKAEEDEEAERILPGILNDTLRFGMFLQDLIFMISEEGAVAYDPAANECYCASLSSQVPKN HVSLVTKENQVFVAGGLFYNEDNKEDPMSAYFLQFDHLDSEWLGMPPLPSPRCLFGLGEALNSIYVVGGR EIKDGERCLDSVMCYDRLSFKWGESDPLPYVVYGHTVLSHMDLVYVIGGKGSDRKCLNKMCVYDPKKFEW KELAPMQTARSLFGATVHDGRIIVAAGVTDTGLTSSAEVYSITDNKWAPFEAFPQERSSLSLVSLVGTLY AIGGFATLETESGELVPTELNDIWRYNEEEKKWEGVLREIAYAAGATFLPVRLNVLCLTKMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | KLHL40 kelch like family member 40 [ Homo sapiens (human) ] |
| Official Symbol | KLHL40 |
| Synonyms | NEM8; SRYP; SYRP; KBTBD5 |
| Gene ID | 131377 |
| mRNA Refseq | NM_152393.4 |
| Protein Refseq | NP_689606.2 |
| MIM | 615340 |
| UniProt ID | Q2TBA0 |
| ◆ Recombinant Proteins | ||
| KLHL40-1510HFL | Recombinant Full Length Human KLHL40 Protein, C-Flag-tagged | +Inquiry |
| KLHL40-1255H | Recombinant Human KLHL40 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Klhl40-3719M | Recombinant Mouse Klhl40 Protein, Myc/DDK-tagged | +Inquiry |
| KLHL40-613H | Recombinant Human KLHL40 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLHL40 Products
Required fields are marked with *
My Review for All KLHL40 Products
Required fields are marked with *
