Recombinant Full Length Human KNCN Protein, GST-tagged
Cat.No. : | KNCN-5782HF |
Product Overview : | Human KNCN full-length ORF ( AAI01297.1, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 136 amino acids |
Description : | KNCN (Kinocilin) is a Protein Coding gene. |
Molecular Mass : | 41.5 kDa |
AA Sequence : | MLRQSLSGCPCPALPSCLLPLCQCPPGLGDPDRRQARPCRPQSGWEQCLEWGLLHSPGQASPKWIPLVWAGTWSKVSPDAPTGFPCFRLLPWPFFLDCSSALLPVQSTDLFLWNLGSRALTMTRMPQSLALTRLQK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KNCN kinocilin [ Homo sapiens ] |
Official Symbol | KNCN |
Synonyms | L5; Kino; RP11-49P4.2; KNCN; kinocilin |
Gene ID | 148930 |
mRNA Refseq | NM_001097611 |
Protein Refseq | NP_001091080 |
MIM | 611455 |
UniProt ID | A6PVL3 |
◆ Recombinant Proteins | ||
RFL7625HF | Recombinant Full Length Human Kinocilin(Kncn) Protein, His-Tagged | +Inquiry |
KNCN-4891M | Recombinant Mouse KNCN Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL9150MF | Recombinant Full Length Mouse Kinocilin(Kncn) Protein, His-Tagged | +Inquiry |
KNCN-441H | Recombinant Human KNCN, GST-tagged | +Inquiry |
KNCN-4903H | Recombinant Human KNCN Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KNCN Products
Required fields are marked with *
My Review for All KNCN Products
Required fields are marked with *
0
Inquiry Basket