Recombinant Human KNCN Protein, GST-tagged

• Cat.No.: KNCN-4903H
• Product Overview: Human KNCN full-length ORF ( AAI01297.1, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: KNCN (Kinocilin) is a Protein Coding gene.
• Molecular Mass: 41.5 kDa
• AA Sequence: MLRQSLSGCPCPALPSCLLPLCQCPPGLGDPDRRQARPCRPQSGWEQCLEWGLLHSPGQASPKWIPLVWAGTWSKVSPDAPTGFPCFRLLPWPFFLDCSSALLPVQSTDLFLWNLGSRALTMTRMPQSLALTRLQK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KNCN kinocilin [ Homo sapiens ]
• Official Symbol: KNCN
• Synonyms: L5; Kino; RP11-49P4.2; KNCN; kinocilin
• Gene ID: 148930
• mRNA Refseq: NM_001097611
• Protein Refseq: NP_001091080
• MIM: 611455
• UniProt ID: A6PVL3