Recombinant Full Length Human KRR1 Protein, GST-tagged

Cat.No. : KRR1-5918HF
Product Overview : Human KRR1 full-length ORF ( AAH26107.1, 1 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 381 amino acids
Description : KRR1 (KRR1, Small Subunit Processome Component Homolog) is a Protein Coding gene. Diseases associated with KRR1 include Hiv-1. Among its related pathways are rRNA processing in the nucleus and cytosol and Gene Expression. GO annotations related to this gene include nucleic acid binding and RNA binding.
Molecular Mass : 70 kDa
AA Sequence : MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVALDTMKNIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELASGEYFLKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEADEKKKKKKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KRR1 KRR1, small subunit (SSU) processome component, homolog (yeast) [ Homo sapiens ]
Official Symbol KRR1
Synonyms KRR1; KRR1, small subunit (SSU) processome component, homolog (yeast); HIV 1 Rev binding protein 2 , HIV 1 rev binding protein 2 , HRB2; KRR1 small subunit processome component homolog; RIP 1; Rev interacting protein; rev-interacting protein 1; HIV-1 Rev binding protein 2; HIV-1 Rev-binding protein 2; KRR-R motif-containing protein 1; HRB2; RIP-1;
Gene ID 11103
mRNA Refseq NM_007043
Protein Refseq NP_008974
MIM 612817
UniProt ID Q13601

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KRR1 Products

Required fields are marked with *

My Review for All KRR1 Products

Required fields are marked with *

0
cart-icon