Recombinant Human KRR1 Protein, GST-tagged
Cat.No. : | KRR1-4877H |
Product Overview : | Human KRR1 full-length ORF ( AAH26107.1, 1 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | KRR1 (KRR1, Small Subunit Processome Component Homolog) is a Protein Coding gene. Diseases associated with KRR1 include Hiv-1. Among its related pathways are rRNA processing in the nucleus and cytosol and Gene Expression. GO annotations related to this gene include nucleic acid binding and RNA binding. |
Molecular Mass : | 70 kDa |
AA Sequence : | MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVALDTMKNIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELASGEYFLKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEADEKKKKKKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KRR1 KRR1, small subunit (SSU) processome component, homolog (yeast) [ Homo sapiens ] |
Official Symbol | KRR1 |
Synonyms | KRR1; KRR1, small subunit (SSU) processome component, homolog (yeast); HIV 1 Rev binding protein 2 , HIV 1 rev binding protein 2 , HRB2; KRR1 small subunit processome component homolog; RIP 1; Rev interacting protein; rev-interacting protein 1; HIV-1 Rev binding protein 2; HIV-1 Rev-binding protein 2; KRR-R motif-containing protein 1; HRB2; RIP-1; |
Gene ID | 11103 |
mRNA Refseq | NM_007043 |
Protein Refseq | NP_008974 |
MIM | 612817 |
UniProt ID | Q13601 |
◆ Recombinant Proteins | ||
KRR1-4909M | Recombinant Mouse KRR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRR1-4877H | Recombinant Human KRR1 Protein, GST-tagged | +Inquiry |
KRR1-450H | Recombinant Human KRR1, GST-tagged | +Inquiry |
KRR1-2445C | Recombinant Chicken KRR1 | +Inquiry |
KRR1-5918HF | Recombinant Full Length Human KRR1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KRR1-4882HCL | Recombinant Human KRR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRR1 Products
Required fields are marked with *
My Review for All KRR1 Products
Required fields are marked with *