Recombinant Full Length Human KRTAP4-12 Protein, GST-tagged
Cat.No. : | KRTAP4-12-5818HF |
Product Overview : | Human KRTAP4-12 full-length ORF (AAH04180.1, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 201 amino acids |
Description : | This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the ultrahigh sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21. [provided by RefSeq |
Molecular Mass : | 48.51 kDa |
AA Sequence : | MVNSCCGSVCSDQGCGLENCCRPSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPTCCRPSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPTCCRPSCCQTTCCRTTCCRPSCCVSSCCRPQCCQSVCCQPTCCRPSCCISSSCCPSCCESSCCRPCCCLRPVCGRVSCHTTCYRPTCVISTCPRPLCCASSCC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KRTAP4-12 keratin associated protein 4-12 [ Homo sapiens (human) ] |
Official Symbol | KRTAP4-12 |
Synonyms | KRTAP4-12; keratin associated protein 4-12; KAP4.12; KRTAP4.12; keratin-associated protein 4-12; keratin-associated protein 4.12; ultrahigh sulfur keratin-associated protein 4.12 |
Gene ID | https://www.ncbi.nlm.nih.gov/gene/?term=83755 |
mRNA Refseq | NM_031854 |
Protein Refseq | NP_114060 |
UniProt ID | Q9BQ66 |
◆ Recombinant Proteins | ||
KRTAP4-12-3293H | Recombinant Human KRTAP4-12 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRTAP4-12-4812H | Recombinant Human KRTAP4-12 Protein, GST-tagged | +Inquiry |
KRTAP4-12-1315H | Recombinant Human KRTAP4-12 | +Inquiry |
KRTAP4-12-5818HF | Recombinant Full Length Human KRTAP4-12 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRTAP4-12 Products
Required fields are marked with *
My Review for All KRTAP4-12 Products
Required fields are marked with *