Recombinant Full Length Human KRTAP5-11 Protein, GST-tagged

Cat.No. : KRTAP5-11-5825HF
Product Overview : Human KRTAP5-11 full-length ORF ( AAI48464.1, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 156 amino acids
Description : KRTAP5-11 (Keratin Associated Protein 5-11) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology.
Molecular Mass : 43.56 kDa
AA Sequence : MGCCGCSGGCGSGCGGCGSGSGGCGSGCGGCGSSCCVPICCCKPVCCCVPACSCSSCGSCGGSKGGCGSCGSSKGGCGSCGCSQSNCCKPCCSSSGCGSFCCQSSCSKPCCCQSSCCQSSCCKPCCCQSSCCQSSCFKPCCCQSSCCVPVCCQCKI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KRTAP5-11 keratin associated protein 5-11 [ Homo sapiens (human) ]
Official Symbol KRTAP5-11
Synonyms KRTAP5-11; keratin associated protein 5-11; KRTAP5-5; KRTAP5-6; KRTAP5.11; keratin-associated protein 5-11; keratin associated protein 5-5; keratin-associated protein 5.11; ultrahigh sulfur keratin-associated protein 5.11
Gene ID 440051
mRNA Refseq NM_001005405
Protein Refseq NP_001005405
UniProt ID Q6L8G4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KRTAP5-11 Products

Required fields are marked with *

My Review for All KRTAP5-11 Products

Required fields are marked with *

0
cart-icon