Recombinant Full Length Human KYAT3 Protein, GST-tagged

Cat.No. : KYAT3-2801HF
Product Overview : Human CCBL2 full-length ORF (NP_001008661.1, 1 a.a. - 454 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 454 amino acids
Description : This gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid, which is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. This gene shares 5' exon structure with the RNA binding motif protein, X-linked-like 1 locus on chromosome 1, but the coding sequences are non-overlapping. [provided by RefSeq, Mar 2017]
Molecular Mass : 77.8 kDa
AA Sequence : MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQKQIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRSKPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYDTLCISDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESVGLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KYAT3 kynurenine aminotransferase 3 [ Homo sapiens (human) ]
Official Symbol KYAT3
Synonyms KYAT3; kynurenine aminotransferase 3; KAT3; KATIII; RP11-82K18.3; RP4-531M19.2; Kynurenine Aminotransferase 3; Kynurenine--Oxoglutarate Transaminase III; Kynurenine--Oxoglutarate Transaminase 3; Kynurenine--Glyoxylate Transaminase; Cysteine-S-Conjugate Beta-Lyase 2; Kynurenine Aminotransferase III; CCBL2; Cysteine Conjugate Beta Lyase
Gene ID 56267
mRNA Refseq NM_001008662
Protein Refseq NP_001008662
MIM 610656
UniProt ID Q6YP21

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KYAT3 Products

Required fields are marked with *

My Review for All KYAT3 Products

Required fields are marked with *

0
cart-icon