Recombinant Full Length Human LCNL1 Protein, GST-tagged
Cat.No. : | LCNL1-4935HF |
Product Overview : | Human FLJ45224 full-length ORF (BAC86862.1, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 164 amino acids |
Description : | LCNL1 (Lipocalin Like 1) is a Protein Coding gene. An important paralog of this gene is LCN15. |
Molecular Mass : | 44.44 kDa |
AA Sequence : | MVGVVSDDQDFLDSKDTMKMAVVLVTPLGNGDLALKFGYPTPHGGCQKMDTTFTEGAVPGQFSNPAMTLSDIRVAFSDYQHFALLYLEMRKGGLRNQWLQLYGGRAAGRRPRHPRFGSGMSPLCLHQPFLHAEGGTAGSWCLWPRVPAPPCPSLPLFAPPAPSL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LCNL1 lipocalin like 1 [ Homo sapiens (human) ] |
Official Symbol | LCNL1 |
Synonyms | LCNL1; lipocalin like 1; lipocalin-like 1 protein; |
Gene ID | 401562 |
mRNA Refseq | NM_207510 |
Protein Refseq | NP_997393 |
UniProt ID | Q6ZST4 |
◆ Recombinant Proteins | ||
LCNL1-335H | Recombinant Human LCNL1 Protein, His-tagged | +Inquiry |
LCNL1-3345H | Recombinant Human LCNL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LCNL1-4347H | Recombinant Human LCNL1 Protein, GST-tagged | +Inquiry |
LCNL1-1602H | Recombinant Human LCNL1 | +Inquiry |
LCNL1-4935HF | Recombinant Full Length Human LCNL1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LCNL1 Products
Required fields are marked with *
My Review for All LCNL1 Products
Required fields are marked with *