Recombinant Full Length Human LINC00336 Protein, GST-tagged

• Cat.No.: LINC00336-4917HF
• Product Overview: Human FLJ43752 full-length ORF ( NP_997380.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 198 amino acids
• Description: LINC00336 (Long Intergenic Non-Protein Coding RNA 336) is an RNA Gene, and is affiliated with the non-coding RNA class.
• Molecular Mass: 47.3 kDa
• AA Sequence: MRAPAQVRTLRWSLGWPGSRGRDVFAALRCAQALRCQPLGSALPPQAPTRDLGRPQAFDSSRTPGPRPPRSTLRMMETKSPTSPSYGARGKVPPGAGPGSPLSRGAGQGAPLSETRFHHVAQAFLKLLSSSNPPTSASESARIIGVSHCTQPQVASLSDRHCSKVNHTVLSPRKGVPLQLTAAHSSSQEVLATVPFHG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LINC00336 long intergenic non-protein coding RNA 336 [ Homo sapiens (human) ]
• Official Symbol: LINC00336
• Synonyms: LINC00336; long intergenic non-protein coding RNA 336; C6orf227; NCRNA00336; FLJ43752
• Gene ID: 401253
• UniProt ID: Q6ZUF6