Recombinant Full Length Human LINC00336 Protein, GST-tagged
| Cat.No. : | LINC00336-4917HF |
| Product Overview : | Human FLJ43752 full-length ORF ( NP_997380.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 198 amino acids |
| Description : | LINC00336 (Long Intergenic Non-Protein Coding RNA 336) is an RNA Gene, and is affiliated with the non-coding RNA class. |
| Molecular Mass : | 47.3 kDa |
| AA Sequence : | MRAPAQVRTLRWSLGWPGSRGRDVFAALRCAQALRCQPLGSALPPQAPTRDLGRPQAFDSSRTPGPRPPRSTLRMMETKSPTSPSYGARGKVPPGAGPGSPLSRGAGQGAPLSETRFHHVAQAFLKLLSSSNPPTSASESARIIGVSHCTQPQVASLSDRHCSKVNHTVLSPRKGVPLQLTAAHSSSQEVLATVPFHG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LINC00336 long intergenic non-protein coding RNA 336 [ Homo sapiens (human) ] |
| Official Symbol | LINC00336 |
| Synonyms | LINC00336; long intergenic non-protein coding RNA 336; C6orf227; NCRNA00336; FLJ43752 |
| Gene ID | 401253 |
| UniProt ID | Q6ZUF6 |
| ◆ Recombinant Proteins | ||
| LINC00336-4343H | Recombinant Human LINC00336 Protein, GST-tagged | +Inquiry |
| LINC00336-4917HF | Recombinant Full Length Human LINC00336 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LINC00336 Products
Required fields are marked with *
My Review for All LINC00336 Products
Required fields are marked with *
