Recombinant Full Length Human LINC01587 Protein, GST-tagged

• Cat.No.: LINC01587-2651HF
• Product Overview: Human LINC01587 full-length ORF (NP_005741.1, 1 a.a. - 93 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 93 amino acids
• Description: This gene is expressed in neuroblastoma; however, the function of this gene is not yet determined. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.9 kDa
• AA Sequence: MDTQKQIHKTHNSKNQFFTIFFFLSVEFGKEGTRKNFYLLLSIGHYGRKSRRADLGTADTADKTEPECFAASWTFDPNPSVTVSGAHSTAVHQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LINC01587 long intergenic non-protein coding RNA 1587 [ Homo sapiens (human) ]
• Official Symbol: LINC01587
• Synonyms: LINC01587; long intergenic non-protein coding RNA 1587; C4ORF6; chromosome 4 open reading frame 6; uncharacterized protein C4orf6; aC1; expressed in neuroblastoma; C4orf6
• Gene ID: 10141
• mRNA Refseq: NM_005750
• Protein Refseq: NP_005741
• UniProt ID: Q99440