Recombinant Full Length Human LOC403312 Protein, GST-tagged
| Cat.No. : | LOC403312-6405HF |
| Product Overview : | Human MGC39545 full-length ORF ( AAH36197.1, 1 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 196 amino acids |
| Description : | LOC403312 (Putative Uncharacterized Protein MGC39545) is a Protein Coding gene. |
| Molecular Mass : | 47.6 kDa |
| AA Sequence : | MPSGEERRDRQKGRRAGCDTSSTPSNTAPRIPEPGAHPTAARPATAQPPRSLLPPVCSKTIAPPASAAAASGSDTAGMRGLGKAPHSGEGHERGRGNSKMKACNNYQYGYLAKPDTSFWIKCRRWLLADAGRHTQRPFWTFRVSHSPLLEAEAGRPSDVSQLQLGSDLKPKMRRPAGELFSPKDAGWELDPAEKSE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LOC403312 putative uncharacterized protein MGC39545 [ Homo sapiens (human) ] |
| Official Symbol | LOC403312 |
| Synonyms | LOC403312; putative uncharacterized protein MGC39545; putative uncharacterized protein MGC39545 |
| Gene ID | 403312 |
| mRNA Refseq | NM_001301851 |
| Protein Refseq | NP_001288780 |
| ◆ Recombinant Proteins | ||
| LOC403312-6405HF | Recombinant Full Length Human LOC403312 Protein, GST-tagged | +Inquiry |
| LOC403312-5277H | Recombinant Human LOC403312 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LOC403312 Products
Required fields are marked with *
My Review for All LOC403312 Products
Required fields are marked with *
