Recombinant Full Length Human LOC90768 Protein, GST-tagged
| Cat.No. : | LOC90768-6422HF |
| Product Overview : | Human MGC45800 full-length ORF ( AAH33172.1, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 148 amino acids |
| Description : | LOC90768 (Uncharacterized LOC90768) is an RNA Gene, and is affiliated with the ncRNA class. |
| Molecular Mass : | 42.2 kDa |
| AA Sequence : | MGDLSRTALWLGGRRDPSGSFRVRDGAAAEVGRACLGLPSECGSLVRARASPRPLLGPAVGPWRARSPRPGLPRPSPTCPWKRGGDWCALSLVAPAASRHPPLSASEQRIPPTSTCTCTRPLGNPLAFLTTVQNQKQIEHWENKDDAS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LOC90768 uncharacterized LOC90768 [ Homo sapiens (human) ] |
| Official Symbol | LOC90768 |
| Synonyms | LOC90768; uncharacterized LOC90768; |
| Gene ID | 90768 |
| ◆ Recombinant Proteins | ||
| LOC90768-5288H | Recombinant Human LOC90768 Protein, GST-tagged | +Inquiry |
| LOC90768-6422HF | Recombinant Full Length Human LOC90768 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LOC90768 Products
Required fields are marked with *
My Review for All LOC90768 Products
Required fields are marked with *
