Recombinant Full Length Human LOC90768 Protein, GST-tagged

Cat.No. : LOC90768-6422HF
Product Overview : Human MGC45800 full-length ORF ( AAH33172.1, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 148 amino acids
Description : LOC90768 (Uncharacterized LOC90768) is an RNA Gene, and is affiliated with the ncRNA class.
Molecular Mass : 42.2 kDa
AA Sequence : MGDLSRTALWLGGRRDPSGSFRVRDGAAAEVGRACLGLPSECGSLVRARASPRPLLGPAVGPWRARSPRPGLPRPSPTCPWKRGGDWCALSLVAPAASRHPPLSASEQRIPPTSTCTCTRPLGNPLAFLTTVQNQKQIEHWENKDDAS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LOC90768 uncharacterized LOC90768 [ Homo sapiens (human) ]
Official Symbol LOC90768
Synonyms LOC90768; uncharacterized LOC90768;
Gene ID 90768

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LOC90768 Products

Required fields are marked with *

My Review for All LOC90768 Products

Required fields are marked with *

0
cart-icon
0
compare icon