Recombinant Full Length Human LRRC20 Protein, GST-tagged
| Cat.No. : | LRRC20-5949HF |
| Product Overview : | Human LRRC20 full-length ORF ( NP_997002.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 184 amino acids |
| Description : | LRRC20 (Leucine Rich Repeat Containing 20) is a Protein Coding gene. |
| Molecular Mass : | 46.9 kDa |
| AA Sequence : | MLKKMGEAVARVARKVNETVESGSDTLDLAECKLVSFPIGIYKVLRNVSGQIHLITLANNELKSLTSKFMTTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTALPALETINLEENEIVDVPVEKLAAMPALRSINLRFNPLNAEVRVIAPPLIKFDMLMSPEGARAPLP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LRRC20 leucine rich repeat containing 20 [ Homo sapiens ] |
| Official Symbol | LRRC20 |
| Synonyms | LRRC20; leucine rich repeat containing 20; leucine-rich repeat-containing protein 20; FLJ10751; FLJ10844; |
| Gene ID | 55222 |
| mRNA Refseq | NM_018205 |
| Protein Refseq | NP_060675 |
| UniProt ID | Q8TCA0 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC20 Products
Required fields are marked with *
My Review for All LRRC20 Products
Required fields are marked with *



