Recombinant Full Length Human Metalloreductase Steap3(Steap3) Protein, His-Tagged
Cat.No. : | RFL12316HF |
Product Overview : | Recombinant Full Length Human Metalloreductase STEAP3(STEAP3) Protein (Q658P3) (1-488aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-488) |
Form : | Lyophilized powder |
AA Sequence : | MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRN PKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQ EHLQHRESNAEYLASLFPTCTVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSE MALAMGFMPVDMGSLASAWEVEAMPLRLLPAWKVPTLLALGLFVCFYAYNFVRDVLQPYV QESQNKFFKLPVSVVNTTLPCVAYVLLSLVYLPGVLAAALQLRRGTKYQRFPDWLDHWLQ HRKQIGLLSFFCAALHALYSFCLPLRRAHRYDLVNLAVKQVLANKSHLWVEEEVWRMEIY LSLGVLALGTLSLLAVTSLPSIANSLNWREFSFVQSSLGFVALVLSTLHTLTYGWTRAFE ESRYKFYLPPTFTLTLLVPCVVILAKALFLLPCISRRLARIRRGWERESTIKFTLPTDHA LAEKTSHV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | STEAP3 |
Synonyms | STEAP3; TSAP6; Metalloreductase STEAP3; Dudulin-2; Six-transmembrane epithelial antigen of prostate 3; Tumor suppressor-activated pathway protein 6; hTSAP6; pHyde; hpHyde |
UniProt ID | Q658P3 |
◆ Recombinant Proteins | ||
RFL19310MF | Recombinant Full Length Mouse Metalloreductase Steap3(Steap3) Protein, His-Tagged | +Inquiry |
STEAP3-5120HFL | Recombinant Full Length Human STEAP3 protein, Flag-tagged | +Inquiry |
Steap3-6178M | Recombinant Mouse Steap3 Protein, Myc/DDK-tagged | +Inquiry |
STEAP3-3002H | Recombinant Human STEAP3, His-tagged | +Inquiry |
RFL23080RF | Recombinant Full Length Rat Metalloreductase Steap3(Steap3) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STEAP3 Products
Required fields are marked with *
My Review for All STEAP3 Products
Required fields are marked with *
0
Inquiry Basket