Recombinant Full Length Human MGST3 Protein, GST-tagged

Cat.No. : MGST3-6526HF
Product Overview : Human MGST3 full-length ORF ( AAH00505, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 152 amino acids
Description : The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved the production of leukotrienes and prostaglandin E, important mediators of inflammation. This gene encodes an enzyme which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4. This enzyme also demonstrates glutathione-dependent peroxidase activity towards lipid hydroperoxides. [provided by RefSeq
Molecular Mass : 42.46 kDa
AA Sequence : MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWVKSGLGSGPKCCH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MGST3 microsomal glutathione S-transferase 3 [ Homo sapiens ]
Official Symbol MGST3
Synonyms MGST3; microsomal glutathione S-transferase 3; GST III; microsomal glutathione S transferase III; microsomal GST 3; microsomal GST III; microsomal GST-3; microsomal GST-III; microsomal glutathione S-transferase III; GST-III;
Gene ID 4259
mRNA Refseq NM_004528
Protein Refseq NP_004519
MIM 604564
UniProt ID O14880

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MGST3 Products

Required fields are marked with *

My Review for All MGST3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon