Recombinant Full Length Human Mitochondrial Glutamate Carrier 1(Slc25A22) Protein, His-Tagged
| Cat.No. : | RFL9719HF |
| Product Overview : | Recombinant Full Length Human Mitochondrial glutamate carrier 1(SLC25A22) Protein (Q9H936) (1-323aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-323) |
| Form : | Lyophilized powder |
| AA Sequence : | MADKQISLPAKLINGGIAGLIGVTCVFPIDLAKTRLQNQQNGQRVYTSMSDCLIKTVRSE GYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIV TTPMEMLKIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVEAPAAPRPTATQLTRDLLRS RGIAGLYKGLGATLLRDVPFSVVYFPLFANLNQLGRPASEEKSPFYVSFLAGCVAGSAAA VAVNPCDVVKTRLQSLQRGVNEDTYSGILDCARKILRHEGPSAFLKGAYCRALVIAPLFG IAQVVYFLGIAESLLGLLQDPQA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | SLC25A22 |
| Synonyms | SLC25A22; GC1; Mitochondrial glutamate carrier 1; GC-1; Glutamate/H(+ symporter 1; Solute carrier family 25 member 22 |
| UniProt ID | Q9H936 |
| ◆ Recombinant Proteins | ||
| SLC25A22-0604H | Recombinant Human SLC25A22 Protein (A2-A323), 8×His-MBP, Flag tagged | +Inquiry |
| SLC25A22-12582Z | Recombinant Zebrafish SLC25A22 | +Inquiry |
| SLC25A22-2721H | Recombinant Human SLC25A22, GST-tagged | +Inquiry |
| RFL34149PF | Recombinant Full Length Pongo Abelii Mitochondrial Glutamate Carrier 1(Slc25A22) Protein, His-Tagged | +Inquiry |
| RFL3179MF | Recombinant Full Length Mouse Mitochondrial Glutamate Carrier 1(Slc25A22) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC25A22-1775HCL | Recombinant Human SLC25A22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC25A22 Products
Required fields are marked with *
My Review for All SLC25A22 Products
Required fields are marked with *
