Recombinant Full Length Human MPPED2 Protein, GST-tagged
| Cat.No. : | MPPED2-6333HF |
| Product Overview : | Human MPPED2 full-length ORF ( AAH31582, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 294 amino acids |
| Description : | This gene likely encodes a metallophosphoesterase. The encoded protein may play a role a brain development. Alternatively spliced transcript variants have been described. [provided by RefSeq |
| Molecular Mass : | 58.08 kDa |
| AA Sequence : | MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MPPED2 metallophosphoesterase domain containing 2 [ Homo sapiens ] |
| Official Symbol | MPPED2 |
| Synonyms | MPPED2; metallophosphoesterase domain containing 2; C11orf8, chromosome 11 open reading frame 8; metallophosphoesterase MPPED2; 239FB; D11S302E; dJ873F21.1; dJ1024C24.1; FAM1B; Hs.46638; fetal brain protein 239; metallophosphoesterase domain-containing protein 2; C11orf8; |
| Gene ID | 744 |
| mRNA Refseq | NM_001145399 |
| Protein Refseq | NP_001138871 |
| MIM | 600911 |
| UniProt ID | Q15777 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MPPED2 Products
Required fields are marked with *
My Review for All MPPED2 Products
Required fields are marked with *




