Recombinant Full Length Human MRPS16 Protein, GST-tagged

Cat.No. : MRPS16-6469HF
Product Overview : Human MRPS16 full-length ORF ( AAH21106, 1 a.a. - 137 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 137 amino acids
Description : Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S16P family. The encoded protein is one of the most highly conserved ribosomal proteins between mammalian and yeast mitochondria. Three pseudogenes (located at 8q21.3, 20q13.32, 22q12-q13.1) for this gene have been described. [provided by RefSeq
Molecular Mass : 40.81 kDa
AA Sequence : MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MRPS16 mitochondrial ribosomal protein S16 [ Homo sapiens (human) ]
Official Symbol MRPS16
Synonyms MRPS16; mitochondrial ribosomal protein S16; COXPD2; RPMS16; CGI-132; MRP-S16; 28S ribosomal protein S16, mitochondrial; S16mt; mitochondrial small ribosomal subunit protein bS16m
Gene ID 51021
mRNA Refseq NM_016065
Protein Refseq NP_057149
MIM 609204
UniProt ID Q9Y3D3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MRPS16 Products

Required fields are marked with *

My Review for All MRPS16 Products

Required fields are marked with *

0
cart-icon
0
compare icon