Recombinant Full Length Human MRPS18B Protein, GST-tagged
Cat.No. : | MRPS18B-6478HF |
Product Overview : | Human MRPS18B full-length ORF ( AAH05373, 1 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 258 amino acids |
Description : | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S18P family. The encoded protein is one of three that has significant sequence similarity to bacterial S18 proteins. The primary sequences of the three human mitochondrial S18 proteins are no more closely related to each other than they are to the prokaryotic S18 proteins. Pseudogenes corresponding to this gene are found on chromosomes 1q and 2q. [provided by RefSeq |
Molecular Mass : | 54.12 kDa |
AA Sequence : | MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSSDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MRPS18B mitochondrial ribosomal protein S18B [ Homo sapiens ] |
Official Symbol | MRPS18B |
Synonyms | MRPS18B; mitochondrial ribosomal protein S18B; 28S ribosomal protein S18b, mitochondrial; C6orf14; HSPC183; MRPS18 2; PTD017; S18mt-b; mrps18-b; MRP-S18-b; mitochondrial ribosomal protein S18-2; 28S ribosomal protein S18-2, mitochondrial; S18amt; MRPS18-2; HumanS18a; MRP-S18-2; DKFZp564H0223; |
Gene ID | 28973 |
mRNA Refseq | NM_014046 |
Protein Refseq | NP_054765 |
MIM | 611982 |
UniProt ID | Q9Y676 |
◆ Recombinant Proteins | ||
MRPS18B-2858R | Recombinant Rhesus monkey MRPS18B Protein, His-tagged | +Inquiry |
MRPS18B-5607H | Recombinant Human MRPS18B Protein, GST-tagged | +Inquiry |
MRPS18B-6478HF | Recombinant Full Length Human MRPS18B Protein, GST-tagged | +Inquiry |
MRPS18B-3450H | Recombinant Human MRPS18B protein, His-tagged | +Inquiry |
MRPS18B-2678R | Recombinant Rhesus Macaque MRPS18B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS18B-4148HCL | Recombinant Human MRPS18B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS18B Products
Required fields are marked with *
My Review for All MRPS18B Products
Required fields are marked with *
0
Inquiry Basket