Recombinant Human MRPS18B protein, His-tagged
Cat.No. : | MRPS18B-3450H |
Product Overview : | Recombinant Human MRPS18B protein(1-258 aa), fused to His tag, was expressed in E. coli. |
Availability | July 04, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-258 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSSDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MRPS18B mitochondrial ribosomal protein S18B [ Homo sapiens ] |
Official Symbol | MRPS18B |
Synonyms | MRPS18B; mitochondrial ribosomal protein S18B; 28S ribosomal protein S18b, mitochondrial; C6orf14; HSPC183; MRPS18 2; PTD017; S18mt-b; mrps18-b; MRP-S18-b; mitochondrial ribosomal protein S18-2; 28S ribosomal protein S18-2, mitochondrial; S18amt; MRPS18-2; HumanS18a; MRP-S18-2; DKFZp564H0223; |
Gene ID | 28973 |
mRNA Refseq | NM_014046 |
Protein Refseq | NP_054765 |
MIM | 611982 |
UniProt ID | Q9Y676 |
◆ Recombinant Proteins | ||
MRPS18B-5716M | Recombinant Mouse MRPS18B Protein, His (Fc)-Avi-tagged | +Inquiry |
MRPS18B-3450H | Recombinant Human MRPS18B protein, His-tagged | +Inquiry |
Mrps18b-4167M | Recombinant Mouse Mrps18b Protein, Myc/DDK-tagged | +Inquiry |
MRPS18B-4120HFL | Recombinant Full Length Human MRPS18B, Flag-tagged | +Inquiry |
MRPS18B-10090M | Recombinant Mouse MRPS18B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MRPS18B-4148HCL | Recombinant Human MRPS18B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRPS18B Products
Required fields are marked with *
My Review for All MRPS18B Products
Required fields are marked with *