Recombinant Human MRPS18B protein, His-tagged

• Cat.No.: MRPS18B-3450H
• Product Overview: Recombinant Human MRPS18B protein(1-258 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-258 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGSRPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSSDPWYPWYNWKQPPERELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: MRPS18B mitochondrial ribosomal protein S18B [ Homo sapiens ]
• Official Symbol: MRPS18B
• Synonyms: MRPS18B; mitochondrial ribosomal protein S18B; 28S ribosomal protein S18b, mitochondrial; C6orf14; HSPC183; MRPS18 2; PTD017; S18mt-b; mrps18-b; MRP-S18-b; mitochondrial ribosomal protein S18-2; 28S ribosomal protein S18-2, mitochondrial; S18amt; MRPS18-2; HumanS18a; MRP-S18-2; DKFZp564H0223
• Gene ID: 28973
• mRNA Refseq: NM_014046
• Protein Refseq: NP_054765
• MIM: 611982
• UniProt ID: Q9Y676