Recombinant Full Length Human MS4A8B Protein, GST-tagged
| Cat.No. : | MS4A8B-6552HF |
| Product Overview : | Human MS4A8B full-length ORF ( AAH22895, 1 a.a. - 250 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 250 amino acids |
| Description : | This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.3, among a cluster of family members. [provided by RefSeq |
| Molecular Mass : | 53.24 kDa |
| AA Sequence : | MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGKTLGAIQIIIGLARIGLGSIMATVLVGEYLSISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIACASSHFGCQLVCCQSSNVSVIYPNIYAANPVITPEPVTSPPSYSSEIQANK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MS4A8B membrane-spanning 4-domains, subfamily A, member 8B [ Homo sapiens ] |
| Official Symbol | MS4A8B |
| Synonyms | MS4A8B; membrane-spanning 4-domains, subfamily A, member 8B; membrane-spanning 4-domains subfamily A member 8B; MS4A4; four-span transmembrane protein 4; 4SPAN4; |
| Gene ID | 83661 |
| mRNA Refseq | NM_031457 |
| Protein Refseq | NP_113645 |
| MIM | 606549 |
| UniProt ID | Q9BY19 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MS4A8B Products
Required fields are marked with *
My Review for All MS4A8B Products
Required fields are marked with *
