Recombinant Full Length Human MUSTN1 Protein, GST-tagged
| Cat.No. : | MUSTN1-6575HF |
| Product Overview : | Human MUSTN1 full-length ORF ( ADR83456.1, 1 a.a. - 82 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 82 amino acids |
| Description : | MUSTN1 (Musculoskeletal, Embryonic Nuclear Protein 1) is a Protein Coding gene. An important paralog of this gene is ENSG00000243696. |
| Molecular Mass : | 9.1 kDa |
| AA Sequence : | MSQAGAQEAPIKKKRPPVKEEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSRTRTGTETVFEKPKAGPTKSVFG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MUSTN1 musculoskeletal, embryonic nuclear protein 1 [ Homo sapiens (human) ] |
| Official Symbol | MUSTN1 |
| Synonyms | MUSTN1; musculoskeletal, embryonic nuclear protein 1; MUSTANG; musculoskeletal embryonic nuclear protein 1; musculoskeletal temporally activated novel |
| Gene ID | 389125 |
| mRNA Refseq | NM_205853 |
| Protein Refseq | NP_995325 |
| MIM | 617195 |
| UniProt ID | Q8IVN3 |
| ◆ Recombinant Proteins | ||
| MUSTN1-10263M | Recombinant Mouse MUSTN1 Protein | +Inquiry |
| MUSTN1-1641H | Recombinant Human MUSTN1 | +Inquiry |
| Mustn1-4227M | Recombinant Mouse Mustn1 Protein, Myc/DDK-tagged | +Inquiry |
| MUSTN1-009H | Recombinant Human MUSTN1 protein, DDK-tagged | +Inquiry |
| MUSTN1-7133C | Recombinant Chicken MUSTN1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MUSTN1-4055HCL | Recombinant Human MUSTN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MUSTN1 Products
Required fields are marked with *
My Review for All MUSTN1 Products
Required fields are marked with *



