Recombinant Full Length Human MUSTN1 Protein, GST-tagged

Cat.No. : MUSTN1-6575HF
Product Overview : Human MUSTN1 full-length ORF ( ADR83456.1, 1 a.a. - 82 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 82 amino acids
Description : MUSTN1 (Musculoskeletal, Embryonic Nuclear Protein 1) is a Protein Coding gene. An important paralog of this gene is ENSG00000243696.
Molecular Mass : 9.1 kDa
AA Sequence : MSQAGAQEAPIKKKRPPVKEEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSRTRTGTETVFEKPKAGPTKSVFG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MUSTN1 musculoskeletal, embryonic nuclear protein 1 [ Homo sapiens (human) ]
Official Symbol MUSTN1
Synonyms MUSTN1; musculoskeletal, embryonic nuclear protein 1; MUSTANG; musculoskeletal embryonic nuclear protein 1; musculoskeletal temporally activated novel
Gene ID 389125
mRNA Refseq NM_205853
Protein Refseq NP_995325
MIM 617195
UniProt ID Q8IVN3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MUSTN1 Products

Required fields are marked with *

My Review for All MUSTN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon