Recombinant Full Length Human MYADM Protein, C-Flag-tagged
| Cat.No. : | MYADM-514HFL |
| Product Overview : | Recombinant Full Length Human MYADM Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Involved in several processes, including negative regulation of heterotypic cell-cell adhesion; negative regulation of macromolecule metabolic process; and negative regulation of protein kinase C signaling. Located in several cellular components, including cortical actin cytoskeleton; membrane raft; and ruffle. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 35.1 kDa |
| AA Sequence : | MPVTVTRTTITTTTTSSSGLGSPMIVGSPRALTQPLGLLRLLQLVSTCVAFSLVASVGAWTGSMGNWSMF TWCFCFSVTLIILIVELCGLQARFPLSWRNFPITFACYAALFCLSASIIYPTTYVQFLSHGRSRDHAIAA TFFSCIACVAYATEVAWTRARPGEITGYMATVPGLLKVLETFVACIIFAFISDPNLYQHQPALEWCVAVY AICFILAAIAILLNLGECTNVLPIPFPSFLSGLALLSVLLYATALVLWPLYQFDEKYGGQPRRSRDVSCS RSHAYYVCAWDRRLAVAILTAINLLAYVADLVHSAHLVFVKVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Transmembrane |
| Full Length : | Full L. |
| Gene Name | MYADM myeloid associated differentiation marker [ Homo sapiens (human) ] |
| Official Symbol | MYADM |
| Synonyms | SB135 |
| Gene ID | 91663 |
| mRNA Refseq | NM_001020818.2 |
| Protein Refseq | NP_001018654.1 |
| MIM | 609959 |
| UniProt ID | Q96S97 |
| ◆ Recombinant Proteins | ||
| MYADM-3491R | Recombinant Rat MYADM Protein, His (Fc)-Avi-tagged | +Inquiry |
| MYADM-10277M | Recombinant Mouse MYADM Protein | +Inquiry |
| MYADM-1459H | Recombinant Human MYADM Protein, His (Fc)-Avi-tagged | +Inquiry |
| MYADM-514HFL | Recombinant Full Length Human MYADM Protein, C-Flag-tagged | +Inquiry |
| MYADM-3832R | Recombinant Rat MYADM Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYADM Products
Required fields are marked with *
My Review for All MYADM Products
Required fields are marked with *
