Recombinant Full Length Human MYCL1 Protein, GST-tagged
| Cat.No. : | MYCL1-6729HF |
| Product Overview : | Human MYCL1 full-length ORF ( NP_005367.1, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 206 amino acids |
| Description : | MYCL (MYCL Proto-Oncogene, BHLH Transcription Factor) is a Protein Coding gene. Diseases associated with MYCL include Apocrine Adenosis Of Breast and Lower Lip Cancer. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and protein dimerization activity. An important paralog of this gene is MYCN. |
| Molecular Mass : | 48.2 kDa |
| AA Sequence : | MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPGAGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFSARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGEPKTQACSGSESPSDSGKDLPEPSKRGPPHGWPKLCPCLRSGIGSSQALGPSPPLFG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MYCL1 v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived (avian) [ Homo sapiens ] |
| Official Symbol | MYCL1 |
| Synonyms | MYCL1; v-myc myelocytomatosis viral oncogene homolog 1, lung carcinoma derived (avian); MYCL, v myc avian myelocytomatosis viral oncogene homolog 1, lung carcinoma derived; protein L-Myc-1; bHLHe38; l myc protein; LMYC; myc related gene from lung cancer; oncogene lmyc; l-myc-1 proto-oncogene; myc-related gene from lung cancer; class E basic helix-loop-helix protein 38; MYCL; |
| Gene ID | 4610 |
| mRNA Refseq | NM_001033081 |
| Protein Refseq | NP_001028253 |
| MIM | 164850 |
| UniProt ID | P12524 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYCL1 Products
Required fields are marked with *
My Review for All MYCL1 Products
Required fields are marked with *
