Recombinant Full Length Human MYL6B Protein, GST-tagged
Cat.No. : | MYL6B-6350HF |
Product Overview : | Human MLC1SA full-length ORF ( NP_002466.1, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 208 amino acids |
Description : | Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. [provided by RefSeq |
Molecular Mass : | 49.2 kDa |
AA Sequence : | MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYL6B myosin, light chain 6B, alkali, smooth muscle and non-muscle [ Homo sapiens ] |
Official Symbol | MYL6B |
Synonyms | MYL6B; myosin, light chain 6B, alkali, smooth muscle and non-muscle; myosin, light polypeptide 6B, alkali, smooth muscle and non muscle; myosin light chain 6B; MLC1SA; myosin light chain 1 slow a; myosin alkali light chain 1 slow a; myosin light chain 1 slow-twitch muscle A isoform; myosin light chain 1, slow-twitch muscle A isoform; smooth muscle and nonmuscle myosin light chain alkali 6B; smooth muscle and non-muscle myosin alkali light chain 6B; myosin, light polypeptide 6B, alkali, smooth muscle and non-muscle; |
Gene ID | 140465 |
mRNA Refseq | NM_001199629 |
Protein Refseq | NP_001186558 |
MIM | 609930 |
UniProt ID | P14649 |
◆ Recombinant Proteins | ||
MYL6B-5380H | Recombinant Human MYL6B Protein, GST-tagged | +Inquiry |
MYL6B-4022H | Recombinant Human MYL6B Protein (Lys5-Glu199), N-His tagged | +Inquiry |
Myl6b-8047R | Recombinant Rat Myl6b protein, His & GST-tagged | +Inquiry |
MYL6B-10318M | Recombinant Mouse MYL6B Protein | +Inquiry |
MYL6B-5848M | Recombinant Mouse MYL6B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL6B-4022HCL | Recombinant Human MYL6B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYL6B Products
Required fields are marked with *
My Review for All MYL6B Products
Required fields are marked with *
0
Inquiry Basket