Recombinant Full Length Human MYOZ1 Protein, GST-tagged

• Cat.No.: MYOZ1-6619HF
• Product Overview: Human MYOZ1 full-length ORF ( NP_067068.1, 1 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 299 amino acids
• Description: The protein encoded by this gene is primarily expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling. [provided by RefSeq, Apr 2012]
• Molecular Mass: 58.1 kDa
• AA Sequence: MPLSGTPAPNKKRKSSKLIMELTGGGQESSGLNLGKKISVPRDVMLEELSLLTNRGSKMFKLRQMRVEKFIYENHPDVFSDSSMDHFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGGSGSAGQYGSDQQHHLGSGSGAGGTGGPAGQAGRGGAAGTAGVGETGSGDQAGGEGKHITVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPVDYNVDIGIPLDGETEEL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYOZ1 myozenin 1 [ Homo sapiens ]
• Official Symbol: MYOZ1
• Synonyms: MYOZ1; myozenin 1; MYOZ, myozenin; myozenin-1; calsarcin 2; CS 2; FATZ; calsarcin-2; filamin-, actinin- and telethonin-binding protein; CS-2; MYOZ
• Gene ID: 58529
• mRNA Refseq: NM_021245
• Protein Refseq: NP_067068
• MIM: 605603
• UniProt ID: Q9NP98