Recombinant Full Length Human MYOZ1 Protein, GST-tagged

Cat.No. : MYOZ1-6619HF
Product Overview : Human MYOZ1 full-length ORF ( NP_067068.1, 1 a.a. - 299 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 299 amino acids
Description : The protein encoded by this gene is primarily expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling. [provided by RefSeq, Apr 2012]
Molecular Mass : 58.1 kDa
AA Sequence : MPLSGTPAPNKKRKSSKLIMELTGGGQESSGLNLGKKISVPRDVMLEELSLLTNRGSKMFKLRQMRVEKFIYENHPDVFSDSSMDHFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGGSGSAGQYGSDQQHHLGSGSGAGGTGGPAGQAGRGGAAGTAGVGETGSGDQAGGEGKHITVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPVDYNVDIGIPLDGETEEL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYOZ1 myozenin 1 [ Homo sapiens ]
Official Symbol MYOZ1
Synonyms MYOZ1; myozenin 1; MYOZ, myozenin; myozenin-1; calsarcin 2; CS 2; FATZ; calsarcin-2; filamin-, actinin- and telethonin-binding protein; CS-2; MYOZ;
Gene ID 58529
mRNA Refseq NM_021245
Protein Refseq NP_067068
MIM 605603
UniProt ID Q9NP98

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MYOZ1 Products

Required fields are marked with *

My Review for All MYOZ1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon