Recombinant Human MYOZ1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MYOZ1-3943H |
Product Overview : | MYOZ1 MS Standard C13 and N15-labeled recombinant protein (NP_067068) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is primarily expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling. |
Molecular Mass : | 31.7 kDa |
AA Sequence : | MPLSGTPAPNKKRKSSKLIMELTGGGQESSGLNLGKKISVPRDVMLEELSLLTNRGSKMFKLRQMRVEKFIYENHPDVFSDSSMDHFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGGSGSAGQYGSDQQHHLGSGSGAGGTGGPAGQAGRGGAAGTAGVGETGSGDQAGGEGKHITVFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPVDYNVDIGIPLDGETEELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MYOZ1 myozenin 1 [ Homo sapiens (human) ] |
Official Symbol | MYOZ1 |
Synonyms | MYOZ1; myozenin 1; MYOZ, myozenin; myozenin-1; calsarcin 2; CS 2; FATZ; calsarcin-2; filamin-, actinin- and telethonin-binding protein; CS-2; MYOZ; |
Gene ID | 58529 |
mRNA Refseq | NM_021245 |
Protein Refseq | NP_067068 |
MIM | 605603 |
UniProt ID | Q9NP98 |
◆ Recombinant Proteins | ||
MYOZ1-3943H | Recombinant Human MYOZ1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MYOZ1-5858H | Recombinant Human MYOZ1 Protein, GST-tagged | +Inquiry |
MYOZ1-10356M | Recombinant Mouse MYOZ1 Protein | +Inquiry |
MYOZ1-6619HF | Recombinant Full Length Human MYOZ1 Protein, GST-tagged | +Inquiry |
Myoz1-4262M | Recombinant Mouse Myoz1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYOZ1-4002HCL | Recombinant Human MYOZ1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYOZ1 Products
Required fields are marked with *
My Review for All MYOZ1 Products
Required fields are marked with *
0
Inquiry Basket