Recombinant Full Length Human NXPE2 Protein, C-Flag-tagged
Cat.No. : | NXPE2-1580HFL |
Product Overview : | Recombinant Full Length Human NXPE2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to be integral component of membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 64.7 kDa |
AA Sequence : | MVEKILIHRILTLFPNAIARKLLLMLTFILIFWIIYLASKDHTKFSFNLENHIILNQGNIFKKYSHSETP LCPAVSPKETELRIKDIMEKLDQQIPPRPFTHVNTTTSATHSTATILNPQDTYCRGDQLDILLEVRDHLG HRKQYGGDFLRARMYSTALMAGASGKVTDFNNGTYLVSFTLFWEGQVSLSLLLIHPSEGVSALWRARNQG CDRIIFTGLFANRSSNVFTECGLTLNTNAELCQYMDDRDQEAFYCVRPQHMPCEALTHMTTRTRNISYLS KEEWRLFHRSNIGVEMMKNFTPIEVIPCNKSENIKKNCQIGMKTPFPSGYTLKKMWITAFCKQIKFNETK NINDCLERKLIYLMGDSTLHQWIYYLQKAVKTLKYFDHHGAGIFKTHVLLDVERHILIQWKKHGHPFVTK KLFSVKDENYIPREIDQVAGDKNTAIVITLGQHFRPFPINIFIRRAINIQKAIERLFLRSPETKVILKTE NTREIEQNAEMFSDFHGYIQNLIIRDIFVDLNVGIIDAWDMTIAYCTNNAHPPDYVIQNQIGMFLNYICTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | NXPE2 neurexophilin and PC-esterase domain family member 2 [ Homo sapiens (human) ] |
Official Symbol | NXPE2 |
Synonyms | FAM55B |
Gene ID | 120406 |
mRNA Refseq | NM_182495.6 |
Protein Refseq | NP_872301.2 |
UniProt ID | Q96DL1 |
◆ Recombinant Proteins | ||
NXPE2-6289M | Recombinant Mouse NXPE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NXPE2-1569H | Recombinant Human NXPE2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL29984MF | Recombinant Full Length Mouse Protein Fam55B(Fam55B) Protein, His-Tagged | +Inquiry |
NXPE2-1971H | Recombinant Human NXPE2 Protein, MYC/DDK-tagged | +Inquiry |
RFL18936HF | Recombinant Full Length Human Protein Fam55B(Fam55B) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NXPE2 Products
Required fields are marked with *
My Review for All NXPE2 Products
Required fields are marked with *
0
Inquiry Basket