Recombinant Full Length Human OGFR Protein, C-Flag-tagged
Cat.No. : | OGFR-1873HFL |
Product Overview : | Recombinant Full Length Human OGFR Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a receptor for opioid growth factor (OGF), also known as [Met(5)]-enkephalin. OGF is a negative regulator of cell proliferation and tissue organization in a variety of processes. The encoded unbound receptor for OGF has been localized to the outer nuclear envelope, where it binds OGF and is translocated into the nucleus. The coding sequence of this gene contains a polymorphic region of 60 nt tandem imperfect repeat units. Several transcripts containing between zero and eight repeat units have been reported. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 73.1 kDa |
AA Sequence : | MDDPDCDSTWEEDEEDAEDAEDEDCEDGEAAGARDADAGDEDEESEEPRAARPSSFQSRMTGSRNWRATR DMCRYRHNYPDLVERDCNGDTPNLSFYRNEIRFLPNGCFIEDILQNWTDNYDLLEDNHSYIQWLFPLREP GVNWHAKPLTLREVEVFKSSQEIQERLVRAYELMLGFYGIRLEDRGTGTVGRAQNYQKRFQNLNWRSHNN LRITRILKSLGELGLEHFQAPLVRFFLEETLVRRELPGVRQSALDYFMFAVRCRHQRRQLVHFAWEHFRP RCKFVWGPQDKLRRFKPSSLPHPLEGSRKVEEEGSPGDPDHEASTQGRTCGPEHSKGGGRVDEGPQPRSV EPQDAGPLERSQGDEAGGHGEDRPEPLSPKESKKRKLELSRREQPPTEPGPQSASEVEKIALNLEGCALS QGSLRTGTQEVGGQDPGEAVQPCRQPLGARVADKVRKRRKVDEGAGDSAAVASGGAQTLALAGSPAPSGH PKAGHSENGVEEDTEGRTGPKEGTPGSPSETPGPSPAGPAGDEPAESPSETPGPRPAGPAGDEPAESPSE TPGPRPAGPAGDEPAESPSETPGPSPAGPTRDEPAESPSETPGPRPAGPAGDEPAESPSETPGPRPAGPA GDEPAESPSETPGPSPAGPTRDEPAKAGEAAELQDAEVESSAKSGKP myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | OGFR opioid growth factor receptor [ Homo sapiens (human) ] |
Official Symbol | OGFR |
Synonyms | 7-60 protein; opioid growth factor receptor; OTTHUMP00000031503; zeta-type opioid receptor |
Gene ID | 11054 |
mRNA Refseq | NM_007346.4 |
Protein Refseq | NP_031372.2 |
MIM | 606459 |
UniProt ID | Q9NZT2 |
◆ Recombinant Proteins | ||
OGFR-1873HFL | Recombinant Full Length Human OGFR Protein, C-Flag-tagged | +Inquiry |
OGFR-31653TH | Recombinant Human OGFR, His-tagged | +Inquiry |
OGFR-3302H | Recombinant Human OGFR protein, His&Myc-tagged | +Inquiry |
OGFR-1369H | Recombinant Human OGFR Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
OGFR-11086M | Recombinant Mouse OGFR Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
OGFR-455HCL | Recombinant Human OGFR lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OGFR Products
Required fields are marked with *
My Review for All OGFR Products
Required fields are marked with *
0
Inquiry Basket