Recombinant Full Length Human PHLDA3 Protein, GST-tagged
| Cat.No. : | PHLDA3-6853HF |
| Product Overview : | Recombinant full-length Human PHLDA3 protein (1-127aa), fused with GST-tag at the N-terminus, was expressed in Wheat Germ and purified by Glutathione Sepharose 4 Fast Flow. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 127 amino acids |
| Description : | p53/TP53-regulated repressor of Akt/AKT1 signaling. Represses AKT1 by preventing AKT1-binding to membrane lipids, thereby inhibiting AKT1 translocation to the cellular membrane and activation. Contributes to p53/TP53-dependent apoptosis by repressing AKT1 activity. Its direct transcription regulation by p53/TP53 may explain how p53/TP53 can negatively regulate AKT1. May act as a tumor suppressor. |
| Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 40.3 kDa |
| AA Sequence : | MTAAATATVLKEGVLEKRSGGLLQLWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVRARQSLGTGTLVS |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | PHLDA3 pleckstrin homology like domain family A member 3 [ Homo sapiens (human) ] |
| Official Symbol | PHLDA3 |
| Synonyms | TIH1 |
| Gene ID | 23612 |
| mRNA Refseq | NM_012396.5 |
| Protein Refseq | NP_036528.1 |
| MIM | 607054 |
| UniProt ID | Q9Y5J5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PHLDA3 Products
Required fields are marked with *
My Review for All PHLDA3 Products
Required fields are marked with *
