Recombinant Full Length Human PPDPFL Protein, GST-tagged
| Cat.No. : | PPDPFL-3921HF |
| Product Overview : | Human C8orf22 full-length ORF ( ACT64580.1, 1 a.a. - 81 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 81 amino acids |
| Description : | Probable regulator of exocrine pancreas development. |
| Molecular Mass : | 9 kDa |
| AA Sequence : | MASVPSIGCLLARNQYYRKSSVSSVSSLTSSDSVNFIDDDKPQQGLPEVAESTWWFKSFFHSEPVLSNVRIKDLSATGMNS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | PPDPFL pancreatic progenitor cell differentiation and proliferation factor like [ Homo sapiens (human) ] |
| Official Symbol | PPDPFL |
| Synonyms | C8orf22; PPDPFL; pancreatic progenitor cell differentiation and proliferation factor like; pancreatic progenitor cell differentiation and proliferation factor-like protein; exocrine differentiation and proliferation factor-like protein |
| Gene ID | 492307 |
| mRNA Refseq | NM_001007176 |
| Protein Refseq | NP_001007177 |
| UniProt ID | Q8WWR9 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PPDPFL Products
Required fields are marked with *
My Review for All PPDPFL Products
Required fields are marked with *
