Recombinant Full Length Human Prokineticin Receptor 1(Prokr1) Protein, His-Tagged
Cat.No. : | RFL28626HF |
Product Overview : | Recombinant Full Length Human Prokineticin receptor 1(PROKR1) Protein (Q8TCW9) (1-393aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-393) |
Form : | Lyophilized powder |
AA Sequence : | METTMGFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFFA AKIVIGMALVGIMLVCGIGNFIFIAALVRYKKLRNLTNLLIANLAISDFLVAIVCCPFEM DYYVVRQLSWEHGHVLCTSVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKCQTAT GLIALVWTVSILIAIPSAYFTTETVLVIVKSQEKIFCGQIWPVDQQLYYKSYFLFIFGIE FVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPF YGFTIVRDFFPTVFVKEKHYLTAFYIVECIAMSNSMINTLCFVTVKNDTVKYFKKIMLLH WKASYNGGKSSADLDLKTIGMPATEEVDCIRLK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PROKR1 |
Synonyms | PROKR1; GPR73; PKR1; Prokineticin receptor 1; PK-R1; G-protein coupled receptor 73; G-protein coupled receptor ZAQ; GPR73a |
UniProt ID | Q8TCW9 |
◆ Recombinant Proteins | ||
PROKR1-1974H | Recombinant Human PROKR1, GST-tagged | +Inquiry |
PROKR1-13432M | Recombinant Mouse PROKR1 Protein | +Inquiry |
RFL30605MF | Recombinant Full Length Mouse Prokineticin Receptor 1(Prokr1) Protein, His-Tagged | +Inquiry |
PROKR1-3905H | Recombinant Human PROKR1 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
PROKR1-1773H | Recombinant Human PROKR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PROKR1 Products
Required fields are marked with *
My Review for All PROKR1 Products
Required fields are marked with *
0
Inquiry Basket