Recombinant Full Length Human Protein Unc-50 Homolog(Unc50) Protein, His-Tagged
| Cat.No. : | RFL18156HF |
| Product Overview : | Recombinant Full Length Human Protein unc-50 homolog(UNC50) Protein (Q53HI1) (1-259aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-259) |
| Form : | Lyophilized powder |
| AA Sequence : | MLPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAWQMLYLFTSP QRVYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTIGFGFVLDMGFFETIKLLLWVVLI DCVGVGLLIATLMWFISNKYLVKRQSRDYDVEWGYAFDVHLNAFYPLLVILHFIQLFFIN HVILTDTFIGYLVGNTLWLVAVGYYIYVTFLGYSALPFLKNTVILLYPFAPLILLYGLSL ALGWNFTHTLCSFYKYRVK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | UNC50 |
| Synonyms | UNC50; UNCL; HSD-23; HSD23; Protein unc-50 homolog; Periodontal ligament-specific protein 22; PDLs22; Protein GMH1 homolog; hGMH1; Uncoordinated-like protein |
| UniProt ID | Q53HI1 |
| ◆ Recombinant Proteins | ||
| RFL5394DF | Recombinant Full Length Danio Rerio Protein Unc-50 Homolog(Unc50) Protein, His-Tagged | +Inquiry |
| UNC50-9915M | Recombinant Mouse UNC50 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL4408BF | Recombinant Full Length Bovine Protein Unc-50 Homolog(Unc50) Protein, His-Tagged | +Inquiry |
| UNC50-6105R | Recombinant Rat UNC50 Protein, His (Fc)-Avi-tagged | +Inquiry |
| UNC50-3598H | Recombinant Human UNC50, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UNC50 Products
Required fields are marked with *
My Review for All UNC50 Products
Required fields are marked with *
