Recombinant Full Length Danio Rerio Protein Unc-50 Homolog(Unc50) Protein, His-Tagged
| Cat.No. : | RFL5394DF | 
| Product Overview : | Recombinant Full Length Danio rerio Protein unc-50 homolog(unc50) Protein (Q7ZUU1) (1-259aa), fused to N-terminal His tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | zebrafish | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | Full Length (1-259) | 
| Form : | Lyophilized powder | 
| AA Sequence : | MLPTSSPQIHRNGSLSERDAARHTAGAKRYKYLRRLLHFRQMDFEFAVWQMLYLFTSPQK VYRNFHYRKQTKDQWARDDPAFLVLLSIWLCVSTVGFGLVLDMGFVETLTLLLWVVFIDC IGVGLLISTLMWFVTNKYLMKHPNRDYDVEWGYAFDVHLNAFYPLLVILHFLQLFFINHV VVISSDWFLGYFVGNTMWLIAIGYYVYITFLGYSALPFLKNTVVLLYPFALLGLLYVLSI SLGWNFTKGLCWFYKHRVQ | 
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. | 
| Gene Name | unc50 | 
| Synonyms | unc50; Protein unc-50 homolog | 
| UniProt ID | Q7ZUU1 | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All unc50 Products
Required fields are marked with *
My Review for All unc50 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            