Recombinant Full Length Human PSPH protein, GST-tagged
| Cat.No. : | PSPH-3385H |
| Product Overview : | Recombinant Human PSPH protein(P78330)(1-225aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-225aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 52 kDa |
| AA Sequence : | MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | PSPH phosphoserine phosphatase [ Homo sapiens ] |
| Official Symbol | PSPH |
| Synonyms | PSPH; phosphoserine phosphatase; PSP; PSPase; L-3-phosphoserine phosphatase; O-phosphoserine phosphohydrolase; PSPHD; |
| Gene ID | 5723 |
| mRNA Refseq | NM_004577 |
| Protein Refseq | NP_004568 |
| MIM | 172480 |
| UniProt ID | P78330 |
| ◆ Recombinant Proteins | ||
| PSPH-767H | Recombinant Human PSPH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PSPH-4562C | Recombinant Chicken PSPH | +Inquiry |
| PSPH-202H | Recombinant Full Length Human PSPH protein, His-tagged | +Inquiry |
| PSPH-4792R | Recombinant Rat PSPH Protein | +Inquiry |
| Psph-164M | Recombinant Mouse Psph Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PSPH-1430HCL | Recombinant Human PSPH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PSPH Products
Required fields are marked with *
My Review for All PSPH Products
Required fields are marked with *
