Recombinant Full Length Human Rab interacting lysosomal protein like 1 Protein, GST tagged

• Cat.No.: RILPL1-12HFL
• Product Overview: human RILPL1 full-length ORF (NP_847884.1, 1-362aa) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-362aa
• Description: Predicted to enable protein dimerization activity. Predicted to be involved in several processes, including cilium assembly; epithelial cell morphogenesis; and protein transport from ciliary membrane to plasma membrane. Located in cytosol; nucleoplasm; and plasma membrane.
• Tag: N-GST
• Molecular Mass: 68.6 kDa
• AA Sequence: MDVYDIASLVGHEFERVIDQHGCEAIARLMPKVVRVLEILEVLVSRHHVAPELDELRLELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLSHKDVNFSEEEFQKHEGMSERERQVMKKLKEVVDKQRDEIRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRAELGKLRERLQGEHSQNGEEEPETEPVGEESISDAEKVAMDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKSEEMEEENRIPQPPPIAHPRTSPQPESGIKRLIFTAIMPMVAAGLIIDDPTLQPVRRLVSLV
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RILPL1 Rab interacting lysosomal protein like 1 [ Homo sapiens (human) ]
• Official Symbol: RILPL1
• Synonyms: RILPL1; Rab interacting lysosomal protein-like 1; RILP-like protein 1; FLJ39378; rab-interacting lysosomal-like protein 1; RLP1; GOSPEL; MGC99793; MGC105128
• Gene ID: 353116
• mRNA Refseq: NM_178314
• Protein Refseq: NP_847884
• MIM: 614092
• UniProt ID: Q5EBL4