Recombinant Full Length Human RAB5A protein, His-SUMO-tagged
| Cat.No. : | RAB5A-3403H |
| Product Overview : | Recombinant Human RAB5A protein(P20339)(1-215aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-215aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 39.7 kDa |
| AA Sequence : | MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | RAB5A RAB5A, member RAS oncogene family [ Homo sapiens ] |
| Official Symbol | RAB5A |
| Synonyms | RAB5A; RAB5A, member RAS oncogene family; RAB5; ras-related protein Rab-5A; RAS associated protein RAB5A; RAS-associated protein RAB5A; |
| Gene ID | 5868 |
| mRNA Refseq | NM_004162 |
| Protein Refseq | NP_004153 |
| MIM | 179512 |
| UniProt ID | P20339 |
| ◆ Recombinant Proteins | ||
| Rab5a-1115R | Active Recombinant Rat RAB5A, Member RAS Oncogene Family | +Inquiry |
| RAB5A-1770H | Recombinant Human RAB5A protein, His & T7-tagged | +Inquiry |
| RAB5A-7360M | Recombinant Mouse RAB5A Protein, His (Fc)-Avi-tagged | +Inquiry |
| RAB5A-3256H | Recombinant Human RAB5A Protein (Asp136-Asn491), His tagged | +Inquiry |
| RAB5A-6132H | Recombinant Human RAB5A Protein (Asp136-Asn215), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAB5A-2588HCL | Recombinant Human RAB5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB5A Products
Required fields are marked with *
My Review for All RAB5A Products
Required fields are marked with *
