Recombinant Full Length Human Receptor Activity-Modifying Protein 2(Ramp2) Protein, His-Tagged
| Cat.No. : | RFL7189HF |
| Product Overview : | Recombinant Full Length Human Receptor activity-modifying protein 2(RAMP2) Protein (O60895) (43-175aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (43-175) |
| Form : | Lyophilized powder |
| AA Sequence : | QPLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDVLLAMIIAPICLIPFLITLVVWRSKDSEAQA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | RAMP2 |
| Synonyms | RAMP2; Receptor activity-modifying protein 2; Calcitonin-receptor-like receptor activity-modifying protein 2; CRLR activity-modifying protein 2 |
| UniProt ID | O60895 |
| ◆ Recombinant Proteins | ||
| RAMP2-4579R | Recombinant Rat RAMP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ramp2-6782M | Recombinant Mouse Ramp2 Protein (Ser45-Val159), C-His tagged | +Inquiry |
| RAMP2-6403Z | Recombinant Zebrafish RAMP2 | +Inquiry |
| RAMP2-3751C | Recombinant Chicken RAMP2 | +Inquiry |
| Ramp2-6783M | Recombinant Mouse Ramp2 Protein (Ser45-Val159), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RAMP2-2536HCL | Recombinant Human RAMP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAMP2 Products
Required fields are marked with *
My Review for All RAMP2 Products
Required fields are marked with *




