Recombinant Full Length Human REXO2 Protein, C-Flag-tagged
Cat.No. : | REXO2-1495HFL |
Product Overview : | Recombinant Full Length Human REXO2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a 3'-to-5' exonuclease specific for small (primarily 5 nucleotides or less in length) single-stranded RNA and DNA oligomers. This protein may have a role in DNA repair, replication, and recombination, and in RNA processing and degradation. It may also be involved in resistance of human cells to UV-C-induced cell death through its role in the DNA repair process. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 26.7 kDa |
AA Sequence : | MLGGSLGSRLLRGVGGSHGRFGARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDS DLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLA GNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISESIKELQFY RNNIFKKKIDEKKRKIIENGENEKTVSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | REXO2 RNA exonuclease 2 [ Homo sapiens (human) ] |
Official Symbol | REXO2 |
Synonyms | RFN; SFN; REX2; CGI-114 |
Gene ID | 25996 |
mRNA Refseq | NM_015523.4 |
Protein Refseq | NP_056338.2 |
MIM | 607149 |
UniProt ID | Q9Y3B8 |
◆ Recombinant Proteins | ||
REXO2-4714HF | Recombinant Full Length Human REXO2 Protein, GST-tagged | +Inquiry |
REXO2-5377C | Recombinant Chicken REXO2 | +Inquiry |
REXO2-598C | Recombinant Cynomolgus Monkey REXO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Rexo2-261M | Recombinant Mouse Rexo2 Protein, MYC/DDK-tagged | +Inquiry |
REXO2-3672R | Recombinant Rhesus Macaque REXO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
REXO2-2413HCL | Recombinant Human REXO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All REXO2 Products
Required fields are marked with *
My Review for All REXO2 Products
Required fields are marked with *
0
Inquiry Basket